Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g091630.2.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 822aa    MW: 89849.9 Da    PI: 6.2812
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g091630.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r eL+k+l+L++rqVk+WFqNrR+++k
                         688999***********************************************999 PP

               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+a+ +ep+W++s     e++n +e++++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    +
                         5899**************************************9999********************************.************ PP

               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                          +t++vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +  + +  +++lpSg+++++++ng+s
                         ****************************************************************999************************ PP

               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvtwveh+++++   h l+r+l++ g+ +ga++wvatlqrqce+
                         ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.637123183IPR001356Homeobox domain
SMARTSM003895.2E-19124187IPR001356Homeobox domain
CDDcd000865.34E-19125183No hitNo description
PfamPF000461.7E-18126181IPR001356Homeobox domain
PROSITE patternPS000270158181IPR017970Homeobox, conserved site
PROSITE profilePS5084843.74324560IPR002913START domain
SuperFamilySSF559613.3E-31326557No hitNo description
CDDcd088751.78E-122328556No hitNo description
SMARTSM002345.5E-48333557IPR002913START domain
PfamPF018526.9E-54333557IPR002913START domain
SuperFamilySSF559611.19E-23576807No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000022anatomyplant cuticle
PO:0001002developmental stagefruit development stage
Sequence ? help Back to Top
Protein Sequence    Length: 822 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.160290.0flower| fruit| leaf
Function -- GeneRIF ? help Back to Top
  1. These data provide new insight into the role of CD2 and ANL2 in regulating diverse metabolic pathways and in particular, those associated with epidermal cells.
    [PMID: 22623518]
  2. Results indicate that CD2 is essential both for normal cutin and wax deposition and for proper accumulation of specific metabolite.
    [PMID: 23912028]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2221850.0Solanum lycopersicum cultivar M82 cutin deficient 2 (CD2) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234657.20.0cutin deficient 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK4AZA30.0K4AZA3_SOLLC; Uncharacterized protein
STRINGSolyc01g091630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
  2. Isaacson T, et al.
    Cutin deficiency in the tomato fruit cuticle consistently affects resistance to microbial infection and biomechanical properties, but not transpirational water loss.
    Plant J., 2009. 60(2): p. 363-77
  3. Nadakuduti SS, et al.
    Pleiotropic phenotypes of the sticky peel mutant provide new insight into the role of CUTIN DEFICIENT2 in epidermal cell function in tomato.
    Plant Physiol., 2012. 159(3): p. 945-60
  4. Kimbara J, et al.
    Inhibition of CUTIN DEFICIENT 2 Causes Defects in Cuticle Function and Structure and Metabolite Changes in Tomato Fruit.
    Plant Cell Physiol., 2013. 54(9): p. 1535-48